Loading...
Statistics
ppedv HTML5 Camp - In 5 Tagen zum Web-Profi
www.html5camp.de/
Zum Web-Profi in 5 Tagen mit dem HTML5 Camp - Besuchen Sie jetzt das neue HTML5 Camp und werden Sie in 5 Tagen zum Experten für HTML5 und CSS3 ab 3099 â ...
Html5camp.de
Html5camp.de is hosted in
Germany
.
Html5camp.de uses HTTPS protocol.
Number of used technologies:
7.
First technologies:
CSS, Html, Html5,
Number of used javascripts: 10.
First javascripts:
Jquery-1.7.min.js, Superfish.js, Script.js,
Number of used analytics tools:
2.
First analytics tools:
Google AdWords Conversion Tracking, Google Remarketing,
Its server type is:
Microsoft-IIS/8.5.
Technologies in use by Html5camp.de
Technology
Number of occurences: 7
- CSS
- Html
- Html5
- Javascript
- jQuery Hover Intent
- Php
- SuperFish
Advertisement
Javascripts
Number of occurences: 10
- jquery-1.7.min.js
- superfish.js
- script.js
- jquery.hoverIntent.js
- FF-cash.js
- tms-0.3.js
- tms_presets.js
- jquery.easing.1.3.js
- forms.js
- conversion.js
Analytics
Number of occurences: 2
- Google AdWords Conversion Tracking
- Google Remarketing
Advertise
Number of occurences: 1
- DoubleClick.Net
Server Type
- Microsoft-IIS/8.5
Powered by
- ASP.NET
Conversion rate optimization |
|
|---|---|
Clickable call number
|
Not founded! |
|
Conversion form (contact form, subcriber)
|
Not founded! |
|
Clickable email
|
Not founded! |
|
CTA (call to action) button
|
Founded! |
|
List
|
Founded! |
|
Image
|
Not founded! |
|
Enhancement
|
Not founded! |
|
Responsive website
|
Not founded! |
|
Facebook sharing
|
Not founded! |
|
Google+ sharing
|
Not founded! |
|
Twitter sharing
|
Not founded! |
|
Linkedin sharing
|
Not founded! |
|
Blog on the webiste
|
Not founded! |
HTTPS (SSL) - Html5camp.de
SSL certificate
- name: /OU=Domain Control Validated/OU=PositiveSSL Wildcard/CN=*.ppedv.de
- subject:
- OU:
- 0: Domain Control Validated
- 1: PositiveSSL Wildcard
- CN: *.ppedv.de
- OU:
- hash: 1c554e39
- issuer:
- C: GB
- ST: Greater Manchester
- L: Salford
- O: COMODO CA Limited
- CN: COMODO RSA Domain Validation Secure Server CA
- version: 2
- serialNumber: 233356167421400214701942887044399962995
- validFrom: 160407000000Z
- validTo: 180424235959Z
- validFrom_time_t: 1459987200
- validTo_time_t: 1524614399
- extensions:
- authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
- subjectKeyIdentifier: 6C:96:6C:DA:FA:55:34:FB:DA:A8:72:2B:28:50:70:FE:53:89:45:48
- keyUsage: Digital Signature, Key Encipherment
- basicConstraints: CA:FALSE
- extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
- certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
- crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
- authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
- subjectAltName: DNS:*.ppedv.de, DNS:ppedv.de
Number of occurences: 2
- Name:
Content: - Name: description
Content: Zum Web-Profi in 5 Tagen mit dem HTML5 Camp - Besuchen Sie jetzt das neue HTML5 Camp und werden Sie in 5 Tagen zum Experten für HTML5 und CSS3 ab 3099 €
Server / Hosting
- IP: 148.251.193.237
- Latitude: 51.30
- Longitude: 9.49
- Country: Germany
Rname
- ns1.nsserve.de
- ns2.nsserve.de
Target
- root.ns1.nsserve.de
HTTP Header Response
HTTP/1.1 200 OK
Cache-Control: private
Content-Length: 15124
Content-Type: text/html; charset=utf-8
Server: Microsoft-IIS/8.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Tue, 26 Apr 2016 14:40:16 GMT
DNS
host: html5camp.de
- class: IN
- ttl: 86400
- type: A
- ip: 148.251.193.237
host: html5camp.de
- class: IN
- ttl: 86400
- type: NS
- target: ns1.nsserve.de
host: html5camp.de
- class: IN
- ttl: 86400
- type: NS
- target: ns2.nsserve.de
host: html5camp.de
- class: IN
- ttl: 86400
- type: SOA
- mname: ns1.nsserve.de
- rname: root.ns1.nsserve.de
- serial: 2015021204
- refresh: 40000
- retry: 7200
- expire: 604800
- minimum-ttl: 86400
Common Typos/Mistakes
This list shows You some spelling mistakes at internet search for this domain.
www.tml5camp.de, www.hetml5camp.de, www.etml5camp.de, www.hdtml5camp.de, www.dtml5camp.de, www.hctml5camp.de, www.ctml5camp.de, www.hutml5camp.de, www.utml5camp.de, www.hjtml5camp.de, www.jtml5camp.de, www.html5camp.de, www.tml5camp.de, www.hbtml5camp.de, www.btml5camp.de, www.hgtml5camp.de, www.gtml5camp.de, www.hml5camp.de, www.htqml5camp.de, www.hqml5camp.de, www.htaml5camp.de, www.haml5camp.de, www.ht ml5camp.de, www.h ml5camp.de, www.htwml5camp.de, www.hwml5camp.de, www.hteml5camp.de, www.heml5camp.de, www.htzml5camp.de, www.hzml5camp.de, www.htxml5camp.de, www.hxml5camp.de, www.htcml5camp.de, www.hcml5camp.de, www.htl5camp.de, www.htmpl5camp.de, www.htpl5camp.de, www.htmol5camp.de, www.htol5camp.de, www.htmil5camp.de, www.htil5camp.de, www.htmkl5camp.de, www.htkl5camp.de, www.htm.l5camp.de, www.ht.l5camp.de, www.htmul5camp.de, www.htul5camp.de, www.htmjl5camp.de, www.htjl5camp.de, www.htmnl5camp.de, www.htnl5camp.de, www.htm-l5camp.de, www.ht-l5camp.de, www.htm5camp.de, www.htmlu5camp.de, www.htmu5camp.de, www.html85camp.de, www.htm85camp.de, www.html95camp.de, www.htm95camp.de, www.htmlj5camp.de, www.htmj5camp.de, www.html05camp.de, www.htm05camp.de, www.htmlm5camp.de, www.htmm5camp.de, www.htmlp5camp.de, www.htmp5camp.de, www.htmlo5camp.de, www.htmo5camp.de, www.htmlcamp.de, www.html5ecamp.de, www.htmlecamp.de, www.html5rcamp.de, www.htmlrcamp.de, www.html52camp.de, www.html2camp.de, www.html5tcamp.de, www.htmltcamp.de, www.html53camp.de, www.html3camp.de, www.html5amp.de, www.html5cdamp.de, www.html5damp.de, www.html5cramp.de, www.html5ramp.de, www.html5ctamp.de, www.html5tamp.de, www.html5cvamp.de, www.html5vamp.de, www.html5cfamp.de, www.html5famp.de, www.html5cgamp.de, www.html5gamp.de, www.html5champ.de, www.html5hamp.de, www.html5cnamp.de, www.html5namp.de, www.html5cmamp.de, www.html5mamp.de, www.html5cjamp.de, www.html5jamp.de, www.html5cmp.de, www.html5caomp.de, www.html5comp.de, www.html5capmp.de, www.html5cpmp.de, www.html5ca9mp.de, www.html5c9mp.de, www.html5camp.de, www.html5cmp.de, www.html5caimp.de, www.html5cimp.de, www.html5caump.de, www.html5cump.de, www.html5cap.de, www.html5campp.de, www.html5capp.de, www.html5camop.de, www.html5caop.de, www.html5camip.de, www.html5caip.de, www.html5camkp.de, www.html5cakp.de, www.html5cam.p.de, www.html5ca.p.de, www.html5camup.de, www.html5caup.de, www.html5camjp.de, www.html5cajp.de, www.html5camnp.de, www.html5canp.de, www.html5cam-p.de, www.html5ca-p.de, www.html5cam.de, www.html5campi.de, www.html5cami.de, www.html5campk.de, www.html5camk.de, www.html5campu.de, www.html5camu.de, www.html5campj.de, www.html5camj.de, www.html5campl.de, www.html5caml.de,
Other websites we recently analyzed
- SkinRash.net
United Kingdom - 176.74.176.186
Server software: Apache/2.2.22 (Ubuntu)
Technology: Html, Javascript, Php
Number of Javascript: 2
Number of meta tags: 1 - БлагоуÑтройÑтво могил.Уборка могил Ðлматы.
ÐгентÑтво по уходу за меÑтами захоронений.БлагоуÑтройÑтво могил.Уборка могил.Ashburn (United States) - 52.6.217.246
Server software: Pepyaka/1.11.3
Technology: CSS, Html, Html5, Javascript, Wix
Number of Javascript: 2
Number of meta tags: 7 - Home — Lca
La Associazione Rete Italiana LCA si pone come punto di riferimento in Italia per i principali operatori in materia di Life Cycle Assessment (LCA), favorendo sia la diffusione della metodologia a livello nazionale, sia lo scambio di esperienze applicative tese a sostenere l’approccio del ciclo di vita. Mira a consolidare e armonizzare gli strumenti di valutazione per lo sviluppo sostenibile e ad organizzare e realizzare attività a livello nazionale e internazionale di formazione, informazione, documentazione e divulgazione scientifica. L’Associazione, inoltre, si pone l’obiettivo di esercitare azioni d’indirizzo presso gli organi istituzionali, tese a sostenere l’approccio del ciclo di vita e la LCA.Italy - 192.107.92.74
Server software: squid/3.5.12
Technology: CloudFlare, CSS, Html, Html5, Javascript
Number of Javascript: 5
Number of meta tags: 4 - seekandyeeshallfind.com
Scottsdale (United States) - 184.168.221.55
Server software: Microsoft-IIS/7.5
Technology: Html, Html5, Iframe - wesell-lv.com | Isimtescil.net | Ücretsiz yapım aşamasında sayfası
Cyprus - 93.89.226.17
Server software: Microsoft-IIS/7.5
Technology: CSS, Html - Campement Kunja - Paradijsje in Zuid-Senegal
Netherlands - 188.93.150.48
Server software: Apache/2.4.10
Technology: Html - edirneevdenevenakliyatfirmalari.com | Isimtescil.net | Ücretsiz yapım aşamasında sayfası
Cyprus - 93.89.226.17
Server software: Microsoft-IIS/7.5
Technology: CSS, Html - uda.wang
Chai Wan (Hong Kong) - 103.51.144.89
Server software: Tengine/1.4.2
Technology: Google Adsense, Html, Javascript, Php
Number of Javascript: 2
Number of meta tags: 1 - Дмитрий Чубаров
San Francisco (United States) - 208.93.0.150
Server software: squid/3.5.14
Technology: AdFox, DoubleClick.Net, CSS, Html, Html5, Iframe, Javascript, Php, SVG, Yandex.Metrika, comScore, Google Analytics, Google Tagmanager
Number of Javascript: 5
Number of meta tags: 2 - KillerLabs
Brea (United States) - 69.163.186.251
Server software: Apache
Technology: CSS, Html